Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 842210..843005 | Replicon | chromosome |
| Accession | NZ_LR130562 | ||
| Organism | Escherichia coli strain MS14384 isolate MS14384 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A658LKE6 |
| Locus tag | EW037_RS04035 | Protein ID | WP_001596171.1 |
| Coordinates | 842210..842584 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EW037_RS04040 | Protein ID | WP_001596170.1 |
| Coordinates | 842631..843005 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW037_RS04010 | 838280..839263 | - | 984 | WP_129766513.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| EW037_RS04015 | 840074..840244 | - | 171 | Protein_778 | IS110 family transposase | - |
| EW037_RS04020 | 840586..841428 | - | 843 | Protein_779 | DUF4942 domain-containing protein | - |
| EW037_RS04025 | 841513..841710 | - | 198 | WP_001596173.1 | DUF957 domain-containing protein | - |
| EW037_RS04030 | 841722..842213 | - | 492 | WP_001596172.1 | hypothetical protein | - |
| EW037_RS04035 | 842210..842584 | - | 375 | WP_001596171.1 | TA system toxin CbtA family protein | Toxin |
| EW037_RS04040 | 842631..843005 | - | 375 | WP_001596170.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EW037_RS04045 | 843168..843389 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| EW037_RS04050 | 843452..843928 | - | 477 | WP_001186726.1 | RadC family protein | - |
| EW037_RS04055 | 843944..844396 | - | 453 | WP_096035156.1 | antirestriction protein | - |
| EW037_RS25415 | 845628..845690 | - | 63 | Protein_788 | antirestriction protein | - |
| EW037_RS04065 | 845782..846264 | - | 483 | Protein_789 | DUF932 domain-containing protein | - |
| EW037_RS04070 | 846388..846621 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 840074..845561 | 5487 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14161.14 Da Isoelectric Point: 6.7041
>T286452 WP_001596171.1 NZ_LR130562:c842584-842210 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLARLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYELVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPDTHVREASRCPSPVTIWQTLLARLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYELVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13813.62 Da Isoelectric Point: 6.7387
>AT286452 WP_001596170.1 NZ_LR130562:c843005-842631 [Escherichia coli]
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLTVYPTPAPATTS
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLTVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|