Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 8516..9009 Replicon plasmid 4
Accession NZ_LR130558
Organism Escherichia coli strain MS14385 isolate MS14385

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag EW040_RS26695 Protein ID WP_001230709.1
Coordinates 8516..8770 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag EW040_RS26700 Protein ID WP_000151456.1
Coordinates 8767..9009 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW040_RS26655 3563..3865 - 303 WP_001096541.1 hypothetical protein -
EW040_RS26660 3955..4614 - 660 WP_016235966.1 AAA family ATPase -
EW040_RS26665 5166..5489 + 324 WP_016235965.1 hypothetical protein -
EW040_RS26670 5843..6187 + 345 WP_001146936.1 type II toxin-antitoxin system RelE/ParE family toxin -
EW040_RS26675 6174..6524 + 351 WP_000127482.1 addiction module antitoxin -
EW040_RS26685 7358..7873 + 516 WP_001025393.1 J domain-containing protein -
EW040_RS26690 7977..8519 + 543 WP_016235963.1 hypothetical protein -
EW040_RS26695 8516..8770 + 255 WP_001230709.1 hypothetical protein Toxin
EW040_RS26700 8767..9009 + 243 WP_000151456.1 hypothetical protein Antitoxin
EW040_RS26710 9580..9873 + 294 WP_000673428.1 hypothetical protein -
EW040_RS26715 10178..10465 + 288 WP_000606467.1 hypothetical protein -
EW040_RS26720 10893..11126 + 234 WP_000093744.1 hypothetical protein -
EW040_RS26725 11202..11504 + 303 WP_000379301.1 hypothetical protein -
EW040_RS26730 11740..11925 + 186 Protein_18 hypothetical protein -
EW040_RS26735 12036..12857 + 822 WP_016235962.1 DUF945 domain-containing protein -
EW040_RS26740 13154..13744 - 591 WP_124047292.1 transglycosylase SLT domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..52792 52792


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T286450 WP_001230709.1 NZ_LR130558:8516-8770 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT286450 WP_000151456.1 NZ_LR130558:8767-9009 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References