Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2013..2620 | Replicon | plasmid 4 |
| Accession | NZ_LR130558 | ||
| Organism | Escherichia coli strain MS14385 isolate MS14385 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | B7LIH8 |
| Locus tag | EW040_RS26635 | Protein ID | WP_000673985.1 |
| Coordinates | 2013..2399 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B7LIH9 |
| Locus tag | EW040_RS26640 | Protein ID | WP_000493532.1 |
| Coordinates | 2396..2620 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW040_RS26625 | 1..858 | + | 858 | WP_000130985.1 | incFII family plasmid replication initiator RepA | - |
| EW040_RS26635 | 2013..2399 | - | 387 | WP_000673985.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| EW040_RS26640 | 2396..2620 | - | 225 | WP_000493532.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| EW040_RS26645 | 2800..3081 | - | 282 | WP_001290347.1 | membrane protein | - |
| EW040_RS26650 | 3243..3527 | - | 285 | WP_000930236.1 | hypothetical protein | - |
| EW040_RS26655 | 3563..3865 | - | 303 | WP_001096541.1 | hypothetical protein | - |
| EW040_RS26660 | 3955..4614 | - | 660 | WP_016235966.1 | AAA family ATPase | - |
| EW040_RS26665 | 5166..5489 | + | 324 | WP_016235965.1 | hypothetical protein | - |
| EW040_RS26670 | 5843..6187 | + | 345 | WP_001146936.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| EW040_RS26675 | 6174..6524 | + | 351 | WP_000127482.1 | addiction module antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..52792 | 52792 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14370.62 Da Isoelectric Point: 7.0732
>T286449 WP_000673985.1 NZ_LR130558:c2399-2013 [Escherichia coli]
MKFVSSQEVIEFHDRLISRDGGVAGMPEPGRADAIIHRVLNMYHYEGVTDIMDLAAVYLVAIARGHIFNDANKRTALFVA
QVFLKRNGVHIISSRISFDEMQIIALNAATGEYNWKMVSDHLKAIILN
MKFVSSQEVIEFHDRLISRDGGVAGMPEPGRADAIIHRVLNMYHYEGVTDIMDLAAVYLVAIARGHIFNDANKRTALFVA
QVFLKRNGVHIISSRISFDEMQIIALNAATGEYNWKMVSDHLKAIILN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086V9Y9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086V9Y8 |