Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 81509..82110 | Replicon | plasmid 3 |
| Accession | NZ_LR130557 | ||
| Organism | Escherichia coli strain MS14385 isolate MS14385 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | EW040_RS26365 | Protein ID | WP_001216045.1 |
| Coordinates | 81509..81889 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | EW040_RS26370 | Protein ID | WP_001190712.1 |
| Coordinates | 81889..82110 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW040_RS26340 | 76949..78433 | - | 1485 | WP_000124155.1 | hypothetical protein | - |
| EW040_RS26345 | 78433..79626 | - | 1194 | WP_000219604.1 | terminase | - |
| EW040_RS26350 | 79713..80165 | - | 453 | WP_001369802.1 | hypothetical protein | - |
| EW040_RS26355 | 80254..81297 | - | 1044 | WP_000648825.1 | DUF968 domain-containing protein | - |
| EW040_RS26360 | 81325..81504 | - | 180 | WP_000113019.1 | hypothetical protein | - |
| EW040_RS26365 | 81509..81889 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| EW040_RS26370 | 81889..82110 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| EW040_RS26375 | 82183..82572 | - | 390 | WP_000506726.1 | DNA repair protein | - |
| EW040_RS26380 | 82696..82947 | - | 252 | WP_001377386.1 | DNA polymerase III subunit theta | - |
| EW040_RS27625 | 83397..83534 | + | 138 | WP_000123562.1 | hypothetical protein | - |
| EW040_RS26390 | 83609..83971 | - | 363 | WP_086722964.1 | hypothetical protein | - |
| EW040_RS26395 | 83968..84900 | - | 933 | WP_113914546.1 | hypothetical protein | - |
| EW040_RS26400 | 84882..85256 | - | 375 | WP_000988658.1 | hypothetical protein | - |
| EW040_RS26405 | 85263..85556 | - | 294 | WP_001677496.1 | hypothetical protein | - |
| EW040_RS26410 | 85735..85968 | - | 234 | WP_000516537.1 | hypothetical protein | - |
| EW040_RS26415 | 86051..86938 | - | 888 | WP_063612277.1 | DUF551 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..112419 | 112419 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T286448 WP_001216045.1 NZ_LR130557:c81889-81509 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |