Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 81509..82110 Replicon plasmid 3
Accession NZ_LR130557
Organism Escherichia coli strain MS14385 isolate MS14385

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag EW040_RS26365 Protein ID WP_001216045.1
Coordinates 81509..81889 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag EW040_RS26370 Protein ID WP_001190712.1
Coordinates 81889..82110 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW040_RS26340 76949..78433 - 1485 WP_000124155.1 hypothetical protein -
EW040_RS26345 78433..79626 - 1194 WP_000219604.1 terminase -
EW040_RS26350 79713..80165 - 453 WP_001369802.1 hypothetical protein -
EW040_RS26355 80254..81297 - 1044 WP_000648825.1 DUF968 domain-containing protein -
EW040_RS26360 81325..81504 - 180 WP_000113019.1 hypothetical protein -
EW040_RS26365 81509..81889 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EW040_RS26370 81889..82110 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EW040_RS26375 82183..82572 - 390 WP_000506726.1 DNA repair protein -
EW040_RS26380 82696..82947 - 252 WP_001377386.1 DNA polymerase III subunit theta -
EW040_RS27625 83397..83534 + 138 WP_000123562.1 hypothetical protein -
EW040_RS26390 83609..83971 - 363 WP_086722964.1 hypothetical protein -
EW040_RS26395 83968..84900 - 933 WP_113914546.1 hypothetical protein -
EW040_RS26400 84882..85256 - 375 WP_000988658.1 hypothetical protein -
EW040_RS26405 85263..85556 - 294 WP_001677496.1 hypothetical protein -
EW040_RS26410 85735..85968 - 234 WP_000516537.1 hypothetical protein -
EW040_RS26415 86051..86938 - 888 WP_063612277.1 DUF551 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..112419 112419


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T286448 WP_001216045.1 NZ_LR130557:c81889-81509 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT286448 WP_001190712.1 NZ_LR130557:c82110-81889 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References