Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 109180..109823 Replicon plasmid 2
Accession NZ_LR130556
Organism Escherichia coli strain MS14385 isolate MS14385

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag EW040_RS25830 Protein ID WP_001034046.1
Coordinates 109407..109823 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag EW040_RS25825 Protein ID WP_001261278.1
Coordinates 109180..109410 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW040_RS25795 104691..104996 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
EW040_RS25800 104998..105216 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
EW040_RS25805 105783..106295 + 513 WP_000151784.1 hypothetical protein -
EW040_RS25810 106329..107462 - 1134 WP_001542067.1 DUF3800 domain-containing protein -
EW040_RS25815 107629..108402 - 774 WP_000905949.1 hypothetical protein -
EW040_RS25820 108415..108915 - 501 WP_000528931.1 hypothetical protein -
EW040_RS25825 109180..109410 + 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
EW040_RS25830 109407..109823 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
EW040_RS25835 109868..113662 - 3795 WP_001144732.1 hypothetical protein -
EW040_RS25840 114043..114273 + 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
EW040_RS25845 114270..114686 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / mph(A) / sul1 / qacE / aadA5 / sitABCD iucA / iucB / iucC / iucD / iutA 1..136397 136397


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T286446 WP_001034046.1 NZ_LR130556:109407-109823 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT286446 WP_001261278.1 NZ_LR130556:109180-109410 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References