Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
| Location | 4664615..4665603 | Replicon | chromosome |
| Accession | NZ_LR130555 | ||
| Organism | Escherichia coli strain MS14385 isolate MS14385 | ||
Toxin (Protein)
| Gene name | panT | Uniprot ID | - |
| Locus tag | EW040_RS22970 | Protein ID | WP_014640052.1 |
| Coordinates | 4664615..4665001 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | panA | Uniprot ID | A0A0J5Z6D5 |
| Locus tag | EW040_RS22975 | Protein ID | WP_000458584.1 |
| Coordinates | 4665031..4665603 (-) | Length | 191 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW040_RS22925 | 4659703..4659948 | - | 246 | WP_000141753.1 | hypothetical protein | - |
| EW040_RS22930 | 4660061..4660371 | + | 311 | Protein_4419 | hypothetical protein | - |
| EW040_RS22935 | 4660386..4660748 | + | 363 | WP_000135682.1 | hypothetical protein | - |
| EW040_RS22940 | 4660814..4661638 | + | 825 | WP_089438609.1 | DUF2303 family protein | - |
| EW040_RS22945 | 4661766..4662302 | + | 537 | WP_000008200.1 | 5'-deoxynucleotidase | - |
| EW040_RS22950 | 4662293..4662655 | + | 363 | WP_001565177.1 | phage protein | - |
| EW040_RS22955 | 4662655..4663464 | + | 810 | WP_000206745.1 | hypothetical protein | - |
| EW040_RS22960 | 4663464..4664036 | + | 573 | WP_001061348.1 | 3'-5' exoribonuclease | - |
| EW040_RS22965 | 4664073..4664354 | + | 282 | WP_001093917.1 | pyocin activator PrtN family protein | - |
| EW040_RS27595 | 4664402..4664575 | - | 174 | WP_000390072.1 | hypothetical protein | - |
| EW040_RS22970 | 4664615..4665001 | - | 387 | WP_014640052.1 | hypothetical protein | Toxin |
| EW040_RS22975 | 4665031..4665603 | - | 573 | WP_000458584.1 | SocA family protein | Antitoxin |
| EW040_RS22980 | 4665839..4665961 | - | 123 | WP_001300034.1 | hypothetical protein | - |
| EW040_RS22985 | 4666323..4667327 | - | 1005 | WP_022646425.1 | DUF2713 family protein | - |
| EW040_RS22990 | 4667645..4668160 | + | 516 | WP_000416263.1 | zinc uptake transcriptional repressor Zur | - |
| EW040_RS22995 | 4668202..4668411 | - | 210 | WP_001296638.1 | CsbD family protein | - |
| EW040_RS23000 | 4668527..4669852 | - | 1326 | WP_001361471.1 | MATE family efflux transporter DinF | - |
| EW040_RS23005 | 4669925..4670533 | - | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4624254..4670533 | 46279 | |
| - | inside | Prophage | - | espX4 | 4613895..4710203 | 96308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14465.40 Da Isoelectric Point: 5.4833
>T286437 WP_014640052.1 NZ_LR130555:c4665001-4664615 [Escherichia coli]
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
Download Length: 387 bp
Antitoxin
Download Length: 191 a.a. Molecular weight: 21973.21 Da Isoelectric Point: 6.0283
>AT286437 WP_000458584.1 NZ_LR130555:c4665603-4665031 [Escherichia coli]
MFCEEKVAQMAAYLLLKRGGRMAYLKLMKLLYLSNRQSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYN
LIETNGHNVSLRSDPREMDADEVFDELSRADIRILDEIYSRYGHMNRFDLANMTHLESVCPEWHDPGNSRKPIDLKEMLI
SEGKSEDEANRIIGKMEESQKLKEFSLQLS
MFCEEKVAQMAAYLLLKRGGRMAYLKLMKLLYLSNRQSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYN
LIETNGHNVSLRSDPREMDADEVFDELSRADIRILDEIYSRYGHMNRFDLANMTHLESVCPEWHDPGNSRKPIDLKEMLI
SEGKSEDEANRIIGKMEESQKLKEFSLQLS
Download Length: 573 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|