Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4173070..4173620 Replicon chromosome
Accession NZ_LR130555
Organism Escherichia coli strain MS14385 isolate MS14385

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag EW040_RS20370 Protein ID WP_001160966.1
Coordinates 4173070..4173384 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag EW040_RS20375 Protein ID WP_000125568.1
Coordinates 4173387..4173620 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW040_RS20345 4168745..4170031 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
EW040_RS20350 4170031..4171020 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
EW040_RS20355 4171017..4171838 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
EW040_RS20360 4171841..4172218 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
EW040_RS20365 4172225..4173073 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
EW040_RS20370 4173070..4173384 - 315 WP_001160966.1 CcdB family protein Toxin
EW040_RS20375 4173387..4173620 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
EW040_RS20380 4173706..4174185 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
EW040_RS20385 4174376..4176238 - 1863 WP_022645165.1 glutathione-regulated potassium-efflux system protein KefC -
EW040_RS20390 4176231..4176761 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
EW040_RS20395 4176869..4178200 - 1332 WP_001183201.1 MFS transporter -
EW040_RS20400 4178258..4178545 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T286433 WP_001160966.1 NZ_LR130555:c4173384-4173070 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT286433 WP_000125568.1 NZ_LR130555:c4173620-4173387 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References