Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3779380..3779998 | Replicon | chromosome |
| Accession | NZ_LR130555 | ||
| Organism | Escherichia coli strain MS14385 isolate MS14385 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | EW040_RS18520 | Protein ID | WP_001291435.1 |
| Coordinates | 3779780..3779998 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | EW040_RS18515 | Protein ID | WP_000344800.1 |
| Coordinates | 3779380..3779754 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW040_RS18505 | 3774469..3775662 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| EW040_RS18510 | 3775685..3778834 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
| EW040_RS18515 | 3779380..3779754 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| EW040_RS18520 | 3779780..3779998 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| EW040_RS18525 | 3780170..3780721 | + | 552 | WP_000102574.1 | maltose O-acetyltransferase | - |
| EW040_RS18530 | 3780837..3781307 | + | 471 | WP_022645280.1 | YlaC family protein | - |
| EW040_RS18535 | 3781471..3783021 | + | 1551 | WP_022645279.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| EW040_RS18540 | 3783063..3783416 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| EW040_RS18550 | 3783795..3784106 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| EW040_RS18555 | 3784137..3784709 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T286431 WP_001291435.1 NZ_LR130555:3779780-3779998 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT286431 WP_000344800.1 NZ_LR130555:3779380-3779754 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |