Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2698749..2699387 | Replicon | chromosome |
Accession | NZ_LR130555 | ||
Organism | Escherichia coli strain MS14385 isolate MS14385 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | EW040_RS13215 | Protein ID | WP_000813794.1 |
Coordinates | 2699211..2699387 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EW040_RS13210 | Protein ID | WP_001270286.1 |
Coordinates | 2698749..2699165 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW040_RS13190 | 2693901..2694842 | - | 942 | WP_022645667.1 | ABC transporter permease | - |
EW040_RS13195 | 2694843..2695856 | - | 1014 | WP_022645666.1 | ABC transporter ATP-binding protein | - |
EW040_RS13200 | 2695874..2697019 | - | 1146 | WP_000047466.1 | ABC transporter substrate-binding protein | - |
EW040_RS13205 | 2697264..2698670 | - | 1407 | WP_022645665.1 | PLP-dependent aminotransferase family protein | - |
EW040_RS13210 | 2698749..2699165 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
EW040_RS13215 | 2699211..2699387 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
EW040_RS13220 | 2699609..2699839 | + | 231 | WP_000491567.1 | DUF2554 family protein | - |
EW040_RS13225 | 2699931..2701892 | - | 1962 | WP_023909195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
EW040_RS13230 | 2701965..2702501 | - | 537 | WP_000429148.1 | DNA-binding transcriptional regulator SutR | - |
EW040_RS13235 | 2702554..2703765 | + | 1212 | WP_071788120.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T286427 WP_000813794.1 NZ_LR130555:c2699387-2699211 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT286427 WP_001270286.1 NZ_LR130555:c2699165-2698749 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|