Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 863139..863974 | Replicon | chromosome |
| Accession | NZ_LR130555 | ||
| Organism | Escherichia coli strain MS14385 isolate MS14385 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0A1A9A5 |
| Locus tag | EW040_RS04160 | Protein ID | WP_001564063.1 |
| Coordinates | 863139..863516 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0A1AEL8 |
| Locus tag | EW040_RS04165 | Protein ID | WP_038432125.1 |
| Coordinates | 863606..863974 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW040_RS04130 | 858267..859415 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| EW040_RS04135 | 859487..860470 | - | 984 | WP_001361242.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| EW040_RS04140 | 861281..861451 | - | 171 | Protein_806 | IS110 family transposase | - |
| EW040_RS04145 | 861793..862635 | - | 843 | Protein_807 | DUF4942 domain-containing protein | - |
| EW040_RS04150 | 862720..862914 | - | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| EW040_RS04155 | 862993..863142 | - | 150 | Protein_809 | hypothetical protein | - |
| EW040_RS04160 | 863139..863516 | - | 378 | WP_001564063.1 | TA system toxin CbtA family protein | Toxin |
| EW040_RS04165 | 863606..863974 | - | 369 | WP_038432125.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EW040_RS04170 | 864137..864358 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EW040_RS04175 | 864423..864899 | - | 477 | WP_021553055.1 | RadC family protein | - |
| EW040_RS04180 | 864915..865394 | - | 480 | WP_001564060.1 | antirestriction protein | - |
| EW040_RS04185 | 865660..866478 | - | 819 | WP_001175165.1 | DUF945 domain-containing protein | - |
| EW040_RS04190 | 866568..866801 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| EW040_RS04195 | 866807..867484 | - | 678 | WP_001564058.1 | hypothetical protein | - |
| EW040_RS04200 | 867635..868315 | - | 681 | WP_001278649.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | papX | 861666..926927 | 65261 | |
| - | flank | IS/Tn | - | - | 861281..861436 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14094.09 Da Isoelectric Point: 7.8045
>T286420 WP_001564063.1 NZ_LR130555:c863516-863139 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13569.31 Da Isoelectric Point: 7.0369
>AT286420 WP_038432125.1 NZ_LR130555:c863974-863606 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1A9A5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1AEL8 |