Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 185628..186240 | Replicon | chromosome |
Accession | NZ_LR130555 | ||
Organism | Escherichia coli strain MS14385 isolate MS14385 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | EW040_RS00855 | Protein ID | WP_000833473.1 |
Coordinates | 185628..185813 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0A1AGA0 |
Locus tag | EW040_RS00860 | Protein ID | WP_022646255.1 |
Coordinates | 185830..186240 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW040_RS00840 | 181094..182389 | + | 1296 | WP_000985736.1 | Fic family protein | - |
EW040_RS00845 | 182497..184035 | + | 1539 | WP_000183976.1 | aldehyde dehydrogenase AldB | - |
EW040_RS00850 | 184076..185155 | - | 1080 | WP_000061477.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
EW040_RS00855 | 185628..185813 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
EW040_RS00860 | 185830..186240 | + | 411 | WP_022646255.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
EW040_RS00865 | 186352..188331 | - | 1980 | WP_022646254.1 | glycoside hydrolase family 127 protein | - |
EW040_RS00870 | 188342..189742 | - | 1401 | WP_001600688.1 | MFS transporter | - |
EW040_RS00875 | 189968..190783 | + | 816 | WP_022646253.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T286418 WP_000833473.1 NZ_LR130555:185628-185813 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15214.08 Da Isoelectric Point: 4.4482
>AT286418 WP_022646255.1 NZ_LR130555:185830-186240 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALAAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALAAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9YXE2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1AGA0 |