Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 103727..104249 Replicon plasmid 2
Accession NZ_LR130553
Organism Escherichia coli strain MS14386 isolate MS14386

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag EW035_RS24075 Protein ID WP_000220560.1
Coordinates 103968..104249 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag EW035_RS24070 Protein ID WP_000121743.1
Coordinates 103727..103978 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW035_RS24030 98887..99042 - 156 WP_032236586.1 hypothetical protein -
EW035_RS24035 99109..99420 - 312 Protein_116 VRR-NUC domain-containing protein -
EW035_RS24040 99495..99752 + 258 Protein_117 transposase -
EW035_RS24045 99765..100918 - 1154 Protein_118 IS30-like element IS30 family transposase -
EW035_RS24050 100983..101231 - 249 Protein_119 transposase -
EW035_RS25005 101292..101435 - 144 WP_152930453.1 hypothetical protein -
EW035_RS24055 101595..102567 - 973 Protein_121 IS5 family transposase -
EW035_RS24070 103727..103978 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
EW035_RS24075 103968..104249 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EW035_RS24080 104397..105377 - 981 WP_129753561.1 IS5-like element ISKpn26 family transposase -
EW035_RS24085 105640..106164 + 525 Protein_125 nitrate/nitrite transporter NarU -
EW035_RS24090 106231..107211 + 981 WP_000019402.1 IS5-like element IS5 family transposase -
EW035_RS24095 107358..108227 + 870 Protein_127 nitrate/nitrite transporter NarU -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA14 / floR / ant(3'')-Ia / sul3 / blaTEM-1B / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / aac(3)-IId - 1..123043 123043
- inside IScluster/Tn - - 99765..107211 7446


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T286414 WP_000220560.1 NZ_LR130553:103968-104249 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT286414 WP_000121743.1 NZ_LR130553:103727-103978 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References