Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 87166..87767 Replicon plasmid 2
Accession NZ_LR130553
Organism Escherichia coli strain MS14386 isolate MS14386

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag EW035_RS23970 Protein ID WP_001216034.1
Coordinates 87166..87546 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag EW035_RS23975 Protein ID WP_001190712.1
Coordinates 87546..87767 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW035_RS23925 82454..83272 - 819 Protein_97 IS5 family transposase -
EW035_RS23930 83289..83986 - 698 Protein_98 IS1 family transposase -
EW035_RS23940 84157..84366 + 210 WP_000874156.1 hypothetical protein -
EW035_RS23945 84477..85328 + 852 WP_000611664.1 hypothetical protein -
EW035_RS23950 85361..85723 - 363 Protein_101 phage antirepressor KilAC domain-containing protein -
EW035_RS23955 85779..86476 + 698 Protein_102 IS1 family transposase -
EW035_RS23960 86490..86954 - 465 Protein_103 hypothetical protein -
EW035_RS23965 86982..87161 - 180 WP_038997082.1 hypothetical protein -
EW035_RS23970 87166..87546 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EW035_RS23975 87546..87767 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EW035_RS23980 87950..89506 + 1557 WP_038997084.1 type I restriction-modification system subunit M -
EW035_RS23985 89503..90741 + 1239 WP_038997080.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA14 / floR / ant(3'')-Ia / sul3 / blaTEM-1B / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / aac(3)-IId - 1..123043 123043


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T286413 WP_001216034.1 NZ_LR130553:c87546-87166 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT286413 WP_001190712.1 NZ_LR130553:c87767-87546 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References