Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3517079..3517697 | Replicon | chromosome |
Accession | NZ_LR130552 | ||
Organism | Escherichia coli strain MS14386 isolate MS14386 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | EW035_RS17010 | Protein ID | WP_001291435.1 |
Coordinates | 3517479..3517697 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | EW035_RS17005 | Protein ID | WP_000344800.1 |
Coordinates | 3517079..3517453 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW035_RS16995 | 3512168..3513361 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
EW035_RS17000 | 3513384..3516533 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
EW035_RS17005 | 3517079..3517453 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
EW035_RS17010 | 3517479..3517697 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
EW035_RS17015 | 3517868..3518419 | + | 552 | WP_000102556.1 | maltose O-acetyltransferase | - |
EW035_RS17020 | 3518535..3519005 | + | 471 | WP_000136192.1 | YlaC family protein | - |
EW035_RS17025 | 3519169..3520719 | + | 1551 | WP_024166621.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
EW035_RS17030 | 3520761..3521114 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
EW035_RS17040 | 3521493..3521804 | + | 312 | WP_000409911.1 | MGMT family protein | - |
EW035_RS17045 | 3521835..3522407 | - | 573 | WP_000779826.1 | lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T286406 WP_001291435.1 NZ_LR130552:3517479-3517697 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT286406 WP_000344800.1 NZ_LR130552:3517079-3517453 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |