Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53667..54403 Replicon plasmid 2
Accession NZ_LR130549
Organism Klebsiella pneumoniae strain KPC2 isolate KPC2

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag EW042_RS27410 Protein ID WP_003026803.1
Coordinates 53921..54403 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag EW042_RS27405 Protein ID WP_003026799.1
Coordinates 53667..53933 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW042_RS27360 49729..50091 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
EW042_RS27365 50141..50491 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
EW042_RS27370 50849..51118 + 270 WP_004152102.1 hypothetical protein -
EW042_RS27375 51106..51681 + 576 WP_004152103.1 hypothetical protein -
EW042_RS27380 51712..52206 + 495 WP_004152104.1 DNA-binding protein -
EW042_RS27385 52250..52618 + 369 WP_004152105.1 hypothetical protein -
EW042_RS27390 52652..52855 + 204 WP_004152106.1 hemolysin expression modulator Hha -
EW042_RS27395 52904..53161 + 258 WP_004152107.1 hypothetical protein -
EW042_RS27400 53237..53491 + 255 WP_004152108.1 hypothetical protein -
EW042_RS27405 53667..53933 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
EW042_RS27410 53921..54403 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
EW042_RS27415 54615..55961 + 1347 WP_020314316.1 ISNCY family transposase -
EW042_RS27420 56462..57716 - 1255 Protein_57 IS3 family transposase -
EW042_RS27425 57804..58766 - 963 WP_004152113.1 M48 family metalloprotease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / mph(A) / sul1 / qacE / aadA2 / dfrA12 / catA1 - 1..207198 207198


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T286394 WP_003026803.1 NZ_LR130549:53921-54403 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT286394 WP_003026799.1 NZ_LR130549:53667-53933 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References