Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5322060..5322685 | Replicon | chromosome |
| Accession | NZ_LR130548 | ||
| Organism | Klebsiella pneumoniae strain KPC2 isolate KPC2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | EW042_RS26735 | Protein ID | WP_002882817.1 |
| Coordinates | 5322060..5322443 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | EW042_RS26740 | Protein ID | WP_004150355.1 |
| Coordinates | 5322443..5322685 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW042_RS26720 | 5319426..5320328 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| EW042_RS26725 | 5320325..5320960 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| EW042_RS26730 | 5320957..5321886 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| EW042_RS26735 | 5322060..5322443 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EW042_RS26740 | 5322443..5322685 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| EW042_RS26745 | 5322890..5323807 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
| EW042_RS26750 | 5323821..5324762 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| EW042_RS26755 | 5324807..5325244 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EW042_RS26760 | 5325241..5326101 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
| EW042_RS26765 | 5326095..5326694 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T286393 WP_002882817.1 NZ_LR130548:c5322443-5322060 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |