Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4123040..4123659 Replicon chromosome
Accession NZ_LR130548
Organism Klebsiella pneumoniae strain KPC2 isolate KPC2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag EW042_RS20810 Protein ID WP_002892050.1
Coordinates 4123441..4123659 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag EW042_RS20805 Protein ID WP_002892066.1
Coordinates 4123040..4123414 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW042_RS20795 4118192..4119385 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
EW042_RS20800 4119408..4122554 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
EW042_RS20805 4123040..4123414 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
EW042_RS20810 4123441..4123659 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
EW042_RS20815 4123818..4124384 + 567 WP_002892030.1 maltose O-acetyltransferase -
EW042_RS29280 4124356..4124496 - 141 WP_004147370.1 hypothetical protein -
EW042_RS20820 4124517..4124987 + 471 WP_002892026.1 YlaC family protein -
EW042_RS20825 4124962..4126413 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
EW042_RS20830 4126514..4127212 + 699 WP_002892021.1 GNAT family N-acetyltransferase -
EW042_RS20835 4127209..4127349 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
EW042_RS20840 4127349..4127612 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T286389 WP_002892050.1 NZ_LR130548:4123441-4123659 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT286389 WP_002892066.1 NZ_LR130548:4123040-4123414 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References