Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 103357..104000 Replicon plasmid 2
Accession NZ_LR130546
Organism Escherichia coli strain B36 isolate B36

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag EW036_RS26440 Protein ID WP_001034046.1
Coordinates 103357..103773 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag EW036_RS26445 Protein ID WP_001261278.1
Coordinates 103770..104000 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW036_RS26425 98494..98910 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
EW036_RS26430 98907..99137 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
EW036_RS26435 99518..103312 + 3795 WP_001144732.1 hypothetical protein -
EW036_RS26440 103357..103773 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
EW036_RS26445 103770..104000 - 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
EW036_RS26450 104265..104765 + 501 WP_000528932.1 hypothetical protein -
EW036_RS26455 104778..105551 + 774 WP_000905949.1 hypothetical protein -
EW036_RS26460 105762..107375 - 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
EW036_RS26465 107406..107756 - 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
EW036_RS26470 107753..108178 - 426 WP_000422741.1 IS66 family insertion sequence hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aadA5 / qacE / sul1 / mph(A) / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr - 1..112588 112588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T286379 WP_001034046.1 NZ_LR130546:c103773-103357 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT286379 WP_001261278.1 NZ_LR130546:c104000-103770 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References