Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 103357..104000 | Replicon | plasmid 2 |
| Accession | NZ_LR130546 | ||
| Organism | Escherichia coli strain B36 isolate B36 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | EW036_RS26440 | Protein ID | WP_001034046.1 |
| Coordinates | 103357..103773 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | EW036_RS26445 | Protein ID | WP_001261278.1 |
| Coordinates | 103770..104000 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW036_RS26425 | 98494..98910 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| EW036_RS26430 | 98907..99137 | - | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| EW036_RS26435 | 99518..103312 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
| EW036_RS26440 | 103357..103773 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EW036_RS26445 | 103770..104000 | - | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| EW036_RS26450 | 104265..104765 | + | 501 | WP_000528932.1 | hypothetical protein | - |
| EW036_RS26455 | 104778..105551 | + | 774 | WP_000905949.1 | hypothetical protein | - |
| EW036_RS26460 | 105762..107375 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| EW036_RS26465 | 107406..107756 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| EW036_RS26470 | 107753..108178 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aadA5 / qacE / sul1 / mph(A) / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..112588 | 112588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T286379 WP_001034046.1 NZ_LR130546:c103773-103357 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |