Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 98494..99137 Replicon plasmid 2
Accession NZ_LR130546
Organism Escherichia coli strain B36 isolate B36

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag EW036_RS26425 Protein ID WP_001034044.1
Coordinates 98494..98910 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag EW036_RS26430 Protein ID WP_001261286.1
Coordinates 98907..99137 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW036_RS26395 93921..94205 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein -
EW036_RS26400 94205..94480 + 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin -
EW036_RS26405 94586..94867 + 282 WP_129685282.1 hypothetical protein -
EW036_RS26410 94896..95593 + 698 Protein_115 IS1 family transposase -
EW036_RS26415 95847..96869 - 1023 WP_000361402.1 helicase UvrD -
EW036_RS26420 96854..98419 - 1566 WP_001128474.1 AAA family ATPase -
EW036_RS26425 98494..98910 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
EW036_RS26430 98907..99137 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
EW036_RS26435 99518..103312 + 3795 WP_001144732.1 hypothetical protein -
EW036_RS26440 103357..103773 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
EW036_RS26445 103770..104000 - 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aadA5 / qacE / sul1 / mph(A) / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr - 1..112588 112588
- flank IS/Tn - - 95090..95593 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T286378 WP_001034044.1 NZ_LR130546:c98910-98494 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT286378 WP_001261286.1 NZ_LR130546:c99137-98907 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References