Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 93921..94480 Replicon plasmid 2
Accession NZ_LR130546
Organism Escherichia coli strain B36 isolate B36

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag EW036_RS26400 Protein ID WP_000421272.1
Coordinates 94205..94480 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag EW036_RS26395 Protein ID WP_001387467.1
Coordinates 93921..94205 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW036_RS26365 89384..89824 - 441 Protein_107 zinc-binding dehydrogenase -
EW036_RS26375 90225..91115 + 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
EW036_RS26380 91140..91520 + 381 WP_000710783.1 Rid family detoxifying hydrolase -
EW036_RS26385 91553..92518 + 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
EW036_RS26390 92564..93316 - 753 WP_000562172.1 IclR family transcriptional regulator -
EW036_RS26395 93921..94205 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
EW036_RS26400 94205..94480 + 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EW036_RS26405 94586..94867 + 282 WP_129685282.1 hypothetical protein -
EW036_RS26410 94896..95593 + 698 Protein_115 IS1 family transposase -
EW036_RS26415 95847..96869 - 1023 WP_000361402.1 helicase UvrD -
EW036_RS26420 96854..98419 - 1566 WP_001128474.1 AAA family ATPase -
EW036_RS26425 98494..98910 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
EW036_RS26430 98907..99137 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aadA5 / qacE / sul1 / mph(A) / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr - 1..112588 112588
- flank IS/Tn - - 95090..95593 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T286377 WP_000421272.1 NZ_LR130546:94205-94480 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT286377 WP_001387467.1 NZ_LR130546:93921-94205 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References