Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4384727..4385547 | Replicon | chromosome |
Accession | NZ_LR130545 | ||
Organism | Escherichia coli strain B36 isolate B36 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | B6I030 |
Locus tag | EW036_RS22015 | Protein ID | WP_001054379.1 |
Coordinates | 4384727..4384984 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | EW036_RS22020 | Protein ID | WP_000123957.1 |
Coordinates | 4384996..4385547 (+) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW036_RS21995 | 4380274..4381254 | + | 981 | WP_000991462.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
EW036_RS22000 | 4381837..4382943 | - | 1107 | Protein_4218 | helicase YjhR | - |
EW036_RS22005 | 4383006..4384153 | + | 1148 | WP_085949154.1 | IS3-like element ISEc52 family transposase | - |
EW036_RS22010 | 4384186..4384350 | + | 165 | Protein_4220 | GNAT family N-acetyltransferase | - |
EW036_RS22015 | 4384727..4384984 | + | 258 | WP_001054379.1 | YjhX family toxin | Toxin |
EW036_RS22020 | 4384996..4385547 | + | 552 | WP_000123957.1 | N-acetyltransferase | Antitoxin |
EW036_RS22025 | 4385599..4386345 | + | 747 | WP_000354249.1 | class I SAM-dependent methyltransferase | - |
EW036_RS22030 | 4386473..4386733 | + | 261 | WP_000077645.1 | hypothetical protein | - |
EW036_RS26750 | 4386771..4386887 | + | 117 | Protein_4225 | VOC family protein | - |
EW036_RS22035 | 4387132..4388253 | + | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
EW036_RS22040 | 4388250..4388528 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
EW036_RS22045 | 4388540..4389853 | + | 1314 | WP_000460845.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimE | 4373348..4393768 | 20420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9568.07 Da Isoelectric Point: 11.1381
>T286369 WP_001054379.1 NZ_LR130545:4384727-4384984 [Escherichia coli]
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20358.34 Da Isoelectric Point: 6.4182
>AT286369 WP_000123957.1 NZ_LR130545:4384996-4385547 [Escherichia coli]
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|