Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3774390..3775008 | Replicon | chromosome |
Accession | NZ_LR130545 | ||
Organism | Escherichia coli strain B36 isolate B36 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | EW036_RS19095 | Protein ID | WP_001291435.1 |
Coordinates | 3774790..3775008 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | EW036_RS19090 | Protein ID | WP_000344800.1 |
Coordinates | 3774390..3774764 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW036_RS19080 | 3769479..3770672 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
EW036_RS19085 | 3770695..3773844 | + | 3150 | WP_001132478.1 | multidrug efflux RND transporter permease subunit | - |
EW036_RS19090 | 3774390..3774764 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
EW036_RS19095 | 3774790..3775008 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
EW036_RS19100 | 3775182..3775733 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
EW036_RS19105 | 3775849..3776319 | + | 471 | WP_000136192.1 | YlaC family protein | - |
EW036_RS19110 | 3776483..3778033 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
EW036_RS19115 | 3778075..3778428 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
EW036_RS19125 | 3778807..3779118 | + | 312 | WP_000409908.1 | MGMT family protein | - |
EW036_RS19130 | 3779149..3779721 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T286365 WP_001291435.1 NZ_LR130545:3774790-3775008 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT286365 WP_000344800.1 NZ_LR130545:3774390-3774764 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |