Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4128404..4129023 Replicon chromosome
Accession NZ_LR130544
Organism Klebsiella variicola strain 03-311-0071 isolate 03-311-0071

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag EW041_RS20285 Protein ID WP_002892050.1
Coordinates 4128805..4129023 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag EW041_RS20280 Protein ID WP_008805436.1
Coordinates 4128404..4128778 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW041_RS20265 4123559..4124752 + 1194 WP_012542667.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
EW041_RS20270 4124775..4127921 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit -
EW041_RS20280 4128404..4128778 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
EW041_RS20285 4128805..4129023 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
EW041_RS20290 4129182..4129748 + 567 WP_008805435.1 maltose O-acetyltransferase -
EW041_RS26860 4129720..4129848 - 129 Protein_3902 hypothetical protein -
EW041_RS20295 4129885..4130355 + 471 WP_008805434.1 YlaC family protein -
EW041_RS20300 4130324..4131781 - 1458 WP_129766090.1 PLP-dependent aminotransferase family protein -
EW041_RS20305 4131882..4132580 + 699 WP_032438712.1 GNAT family N-acetyltransferase -
EW041_RS20310 4132577..4132717 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
EW041_RS20315 4132717..4132980 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T286344 WP_002892050.1 NZ_LR130544:4128805-4129023 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT286344 WP_008805436.1 NZ_LR130544:4128404-4128778 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References