Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1835991..1836581 | Replicon | chromosome |
| Accession | NZ_LR130544 | ||
| Organism | Klebsiella variicola strain 03-311-0071 isolate 03-311-0071 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
| Locus tag | EW041_RS09015 | Protein ID | WP_008804165.1 |
| Coordinates | 1836249..1836581 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
| Locus tag | EW041_RS09010 | Protein ID | WP_012541132.1 |
| Coordinates | 1835991..1836248 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW041_RS08985 | 1831601..1832176 | + | 576 | WP_043875014.1 | hypothetical protein | - |
| EW041_RS08990 | 1832353..1833189 | + | 837 | WP_104458716.1 | alpha/beta hydrolase | - |
| EW041_RS08995 | 1833395..1834366 | + | 972 | WP_072124611.1 | sensor domain-containing diguanylate cyclase | - |
| EW041_RS09000 | 1834363..1835463 | - | 1101 | WP_064160538.1 | phosphotransferase | - |
| EW041_RS09010 | 1835991..1836248 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
| EW041_RS09015 | 1836249..1836581 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EW041_RS09025 | 1836904..1838340 | + | 1437 | WP_042948427.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| EW041_RS09035 | 1838666..1838815 | - | 150 | Protein_1729 | antitoxin | - |
| EW041_RS09040 | 1839019..1839321 | - | 303 | WP_032700907.1 | XRE family transcriptional regulator | - |
| EW041_RS09045 | 1839326..1839679 | - | 354 | WP_008804168.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| EW041_RS09050 | 1839883..1841364 | + | 1482 | WP_008804169.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T286336 WP_008804165.1 NZ_LR130544:1836249-1836581 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LYA2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LZQ3 |