Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 281456..282087 | Replicon | chromosome |
| Accession | NZ_LR130544 | ||
| Organism | Klebsiella variicola strain 03-311-0071 isolate 03-311-0071 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7H4S6Z2 |
| Locus tag | EW041_RS01290 | Protein ID | WP_008806943.1 |
| Coordinates | 281456..281731 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | R4YIG2 |
| Locus tag | EW041_RS01295 | Protein ID | WP_004181489.1 |
| Coordinates | 281728..282087 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW041_RS01270 | 276692..277027 | + | 336 | WP_002921203.1 | universal stress protein UspB | - |
| EW041_RS01275 | 277087..278583 | - | 1497 | WP_008806938.1 | inorganic phosphate transporter PitA | - |
| EW041_RS01280 | 278813..280006 | + | 1194 | WP_012967106.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| EW041_RS01285 | 280046..281059 | - | 1014 | WP_012540371.1 | magnesium transporter | - |
| EW041_RS01290 | 281456..281731 | + | 276 | WP_008806943.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EW041_RS01295 | 281728..282087 | + | 360 | WP_004181489.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EW041_RS01300 | 282115..282516 | - | 402 | WP_048268290.1 | nickel-responsive transcriptional regulator NikR | - |
| EW041_RS01305 | 282504..283295 | - | 792 | WP_012540373.1 | nickel import ATP-binding protein NikE | - |
| EW041_RS01310 | 283292..284056 | - | 765 | WP_048272087.1 | nickel import ATP-binding protein NikD | - |
| EW041_RS01315 | 284056..284889 | - | 834 | WP_008806947.1 | nickel ABC transporter permease subunit NikC | - |
| EW041_RS01320 | 284886..285830 | - | 945 | WP_129765552.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10295.87 Da Isoelectric Point: 10.3900
>T286333 WP_008806943.1 NZ_LR130544:281456-281731 [Klebsiella variicola]
MEQQVLSLRNKQRHTLEQLFKTPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVRP
MEQQVLSLRNKQRHTLEQLFKTPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVRP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13313.02 Da Isoelectric Point: 4.4605
>AT286333 WP_004181489.1 NZ_LR130544:281728-282087 [Klebsiella variicola]
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKMKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKMKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H4S6Z2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2M5Q1 |