Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5290946..5291571 | Replicon | chromosome |
| Accession | NZ_LR130543 | ||
| Organism | Klebsiella variicola strain 04153260899A isolate 04153260899A | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1F2M041 |
| Locus tag | EW039_RS26050 | Protein ID | WP_008807903.1 |
| Coordinates | 5290946..5291329 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | EW039_RS26055 | Protein ID | WP_004150355.1 |
| Coordinates | 5291329..5291571 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW039_RS26035 | 5288313..5289215 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| EW039_RS26040 | 5289212..5289847 | + | 636 | WP_008807902.1 | formate dehydrogenase cytochrome b556 subunit | - |
| EW039_RS26045 | 5289844..5290773 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| EW039_RS26050 | 5290946..5291329 | - | 384 | WP_008807903.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EW039_RS26055 | 5291329..5291571 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| EW039_RS26060 | 5291776..5292693 | + | 918 | WP_032756518.1 | alpha/beta hydrolase | - |
| EW039_RS26065 | 5292708..5293649 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
| EW039_RS26070 | 5293694..5294131 | - | 438 | WP_008807906.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EW039_RS26075 | 5294128..5294988 | - | 861 | WP_008807907.1 | virulence factor BrkB family protein | - |
| EW039_RS26080 | 5294982..5295581 | - | 600 | WP_064142974.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T286332 WP_008807903.1 NZ_LR130543:c5291329-5290946 [Klebsiella variicola]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2M041 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |