Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4742604..4743296 | Replicon | chromosome |
Accession | NZ_LR130543 | ||
Organism | Klebsiella variicola strain 04153260899A isolate 04153260899A |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | EW039_RS23380 | Protein ID | WP_080851713.1 |
Coordinates | 4742604..4742945 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | EW039_RS23385 | Protein ID | WP_040189932.1 |
Coordinates | 4742970..4743296 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW039_RS23365 | 4738345..4740141 | - | 1797 | WP_129678768.1 | hypothetical protein | - |
EW039_RS23370 | 4740143..4741375 | - | 1233 | WP_197724857.1 | metallophosphoesterase | - |
EW039_RS23375 | 4741655..4742488 | - | 834 | WP_080851711.1 | DUF4942 domain-containing protein | - |
EW039_RS23380 | 4742604..4742945 | - | 342 | WP_080851713.1 | TA system toxin CbtA family protein | Toxin |
EW039_RS23385 | 4742970..4743296 | - | 327 | WP_040189932.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
EW039_RS23390 | 4743310..4743786 | - | 477 | WP_080851715.1 | DNA repair protein RadC | - |
EW039_RS23395 | 4743797..4744243 | - | 447 | WP_080851716.1 | antirestriction protein | - |
EW039_RS23400 | 4744466..4745155 | - | 690 | WP_080851718.1 | hypothetical protein | - |
EW039_RS23410 | 4745720..4746610 | - | 891 | WP_080851722.1 | 50S ribosome-binding GTPase | - |
EW039_RS23415 | 4746693..4747781 | - | 1089 | WP_129678769.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4728145..4759127 | 30982 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12746.63 Da Isoelectric Point: 7.8846
>T286330 WP_080851713.1 NZ_LR130543:c4742945-4742604 [Klebsiella variicola]
MKTIPATTQRAAKSCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLADAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQVTGLVRQSPHPSIR
MKTIPATTQRAAKSCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLADAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQVTGLVRQSPHPSIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|