Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1746807..1747397 | Replicon | chromosome |
| Accession | NZ_LR130543 | ||
| Organism | Klebsiella variicola strain 04153260899A isolate 04153260899A | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
| Locus tag | EW039_RS08575 | Protein ID | WP_008804165.1 |
| Coordinates | 1747065..1747397 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
| Locus tag | EW039_RS08570 | Protein ID | WP_012541132.1 |
| Coordinates | 1746807..1747064 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW039_RS08545 | 1742414..1742989 | + | 576 | WP_129678569.1 | hypothetical protein | - |
| EW039_RS08550 | 1743167..1744003 | + | 837 | WP_008804155.1 | alpha/beta hydrolase | - |
| EW039_RS08555 | 1744210..1745181 | + | 972 | WP_016161433.1 | sensor domain-containing diguanylate cyclase | - |
| EW039_RS08560 | 1745178..1746278 | - | 1101 | WP_086631305.1 | phosphotransferase | - |
| EW039_RS08570 | 1746807..1747064 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
| EW039_RS08575 | 1747065..1747397 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EW039_RS08580 | 1748157..1749971 | + | 1815 | WP_064171031.1 | hypothetical protein | - |
| EW039_RS08585 | 1750022..1750948 | + | 927 | WP_110215056.1 | hypothetical protein | - |
| EW039_RS08590 | 1750941..1751399 | + | 459 | WP_086631304.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T286322 WP_008804165.1 NZ_LR130543:1747065-1747397 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LYA2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LZQ3 |