Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 315299..315885 Replicon chromosome
Accession NZ_LR130543
Organism Klebsiella variicola strain 04153260899A isolate 04153260899A

Toxin (Protein)


Gene name doc Uniprot ID A0A2W7TCK5
Locus tag EW039_RS01465 Protein ID WP_008806973.1
Coordinates 315517..315885 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag EW039_RS01460 Protein ID WP_004174006.1
Coordinates 315299..315520 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW039_RS01440 311456..312382 + 927 WP_012540389.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
EW039_RS01445 312379..313656 + 1278 WP_008806971.1 branched chain amino acid ABC transporter permease LivM -
EW039_RS01450 313653..314420 + 768 WP_008806972.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
EW039_RS01455 314422..315135 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
EW039_RS01460 315299..315520 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EW039_RS01465 315517..315885 + 369 WP_008806973.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EW039_RS01470 316177..317493 + 1317 WP_022066271.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
EW039_RS01475 317600..318487 + 888 WP_012967120.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
EW039_RS01480 318484..319329 + 846 WP_008806976.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
EW039_RS01485 319331..320401 + 1071 WP_023323353.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 300528..321138 20610


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13639.01 Da        Isoelectric Point: 7.3191

>T286319 WP_008806973.1 NZ_LR130543:315517-315885 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPDVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLVISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT286319 WP_004174006.1 NZ_LR130543:315299-315520 [Klebsiella variicola]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2W7TCK5

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References