Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5377168..5377793 | Replicon | chromosome |
Accession | NZ_LR130541 | ||
Organism | Klebsiella pneumoniae strain AJ218 isolate AJ218 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | EW045_RS26665 | Protein ID | WP_002882817.1 |
Coordinates | 5377168..5377551 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | EW045_RS26670 | Protein ID | WP_004150355.1 |
Coordinates | 5377551..5377793 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW045_RS26650 | 5374534..5375436 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
EW045_RS26655 | 5375433..5376068 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
EW045_RS26660 | 5376065..5376994 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
EW045_RS26665 | 5377168..5377551 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EW045_RS26670 | 5377551..5377793 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
EW045_RS26675 | 5377998..5378915 | + | 918 | WP_048269632.1 | alpha/beta hydrolase | - |
EW045_RS26680 | 5378929..5379870 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
EW045_RS26685 | 5379915..5380352 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
EW045_RS26690 | 5380349..5381209 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
EW045_RS26695 | 5381203..5381802 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T286316 WP_002882817.1 NZ_LR130541:c5377551-5377168 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |