Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 89149..89816 | Replicon | chromosome |
| Accession | NZ_LR130541 | ||
| Organism | Klebsiella pneumoniae strain AJ218 isolate AJ218 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | EW045_RS00460 | Protein ID | WP_048269603.1 |
| Coordinates | 89149..89469 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | E1IS67 |
| Locus tag | EW045_RS00465 | Protein ID | WP_000052843.1 |
| Coordinates | 89490..89816 (-) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW045_RS00430 | 84803..85852 | - | 1050 | WP_002922967.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| EW045_RS00435 | 86225..86923 | + | 699 | WP_129718166.1 | winged helix-turn-helix transcriptional regulator | - |
| EW045_RS00440 | 86974..87264 | - | 291 | WP_002922965.1 | antibiotic biosynthesis monooxygenase | - |
| EW045_RS00445 | 87266..88273 | - | 1008 | WP_002922964.1 | zinc-binding alcohol dehydrogenase family protein | - |
| EW045_RS00450 | 88386..88853 | - | 468 | WP_002922963.1 | DUF3237 domain-containing protein | - |
| EW045_RS00460 | 89149..89469 | - | 321 | WP_048269603.1 | TA system toxin CbtA family protein | Toxin |
| EW045_RS00465 | 89490..89816 | - | 327 | WP_000052843.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EW045_RS00470 | 89829..90299 | - | 471 | WP_001275770.1 | DNA repair protein RadC | - |
| EW045_RS00475 | 90368..91189 | - | 822 | WP_048269602.1 | DUF945 domain-containing protein | - |
| EW045_RS00480 | 91282..92292 | - | 1011 | WP_001348677.1 | hypothetical protein | - |
| EW045_RS00485 | 92354..93043 | - | 690 | WP_015703837.1 | WYL domain-containing protein | - |
| EW045_RS00490 | 93235..94128 | - | 894 | WP_048269601.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12094.90 Da Isoelectric Point: 5.5873
>T286302 WP_048269603.1 NZ_LR130541:c89469-89149 [Klebsiella pneumoniae]
MKTQPATTPQAAKPCLSPLAVWQMLLTSLLDQHYGLTLNDTPFSDETIIQKHIEAGITLADAVNFLVERYELVRIDQKGF
SVQDQEPWLTSMDVHRARFKLNVERL
MKTQPATTPQAAKPCLSPLAVWQMLLTSLLDQHYGLTLNDTPFSDETIIQKHIEAGITLADAVNFLVERYELVRIDQKGF
SVQDQEPWLTSMDVHRARFKLNVERL
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|