Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 7659..8302 | Replicon | plasmid 2 |
Accession | NZ_LR130540 | ||
Organism | Klebsiella variicola strain AJ055 isolate AJ055 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | EW050_RS27095 | Protein ID | WP_001044770.1 |
Coordinates | 7886..8302 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | EW050_RS27090 | Protein ID | WP_001261282.1 |
Coordinates | 7659..7889 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW050_RS27060 | 3172..3438 | - | 267 | WP_024144810.1 | type II toxin-antitoxin system ParD family antitoxin | - |
EW050_RS27065 | 3669..5342 | - | 1674 | WP_000026497.1 | hypothetical protein | - |
EW050_RS27075 | 5907..6716 | - | 810 | WP_000654269.1 | hypothetical protein | - |
EW050_RS27080 | 6734..7096 | - | 363 | WP_000533745.1 | hypothetical protein | - |
EW050_RS27085 | 7280..7702 | - | 423 | WP_172601094.1 | hypothetical protein | - |
EW050_RS27090 | 7659..7889 | + | 231 | WP_001261282.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EW050_RS27095 | 7886..8302 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EW050_RS27100 | 8376..9938 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
EW050_RS27105 | 9923..10945 | + | 1023 | WP_117253823.1 | DNA helicase UvrD | - |
EW050_RS27110 | 11483..12397 | + | 915 | WP_031592169.1 | HNH endonuclease | - |
EW050_RS27115 | 12583..12933 | - | 351 | WP_129671151.1 | DUF305 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..165705 | 165705 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T286300 WP_001044770.1 NZ_LR130540:7886-8302 [Klebsiella variicola]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |