Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4943282..4943798 | Replicon | chromosome |
Accession | NZ_LR130539 | ||
Organism | Klebsiella variicola strain AJ055 isolate AJ055 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | EW050_RS24280 | Protein ID | WP_002886902.1 |
Coordinates | 4943282..4943566 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | EW050_RS24285 | Protein ID | WP_002886901.1 |
Coordinates | 4943556..4943798 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW050_RS24265 | 4938385..4940040 | + | 1656 | WP_008807132.1 | alpha,alpha-phosphotrehalase | - |
EW050_RS24270 | 4940426..4942564 | + | 2139 | WP_023339462.1 | anaerobic ribonucleoside-triphosphate reductase | - |
EW050_RS24275 | 4942814..4943278 | + | 465 | WP_048331327.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
EW050_RS24280 | 4943282..4943566 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EW050_RS24285 | 4943556..4943798 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EW050_RS24290 | 4943876..4945786 | - | 1911 | WP_032731805.1 | BglG family transcription antiterminator | - |
EW050_RS24295 | 4945809..4946963 | - | 1155 | WP_049164103.1 | lactonase family protein | - |
EW050_RS24300 | 4947089..4947829 | - | 741 | WP_022065398.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T286297 WP_002886902.1 NZ_LR130539:c4943566-4943282 [Klebsiella variicola]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |