Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4209155..4209774 Replicon chromosome
Accession NZ_LR130539
Organism Klebsiella variicola strain AJ055 isolate AJ055

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag EW050_RS20770 Protein ID WP_002892050.1
Coordinates 4209556..4209774 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag EW050_RS20765 Protein ID WP_008805436.1
Coordinates 4209155..4209529 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW050_RS20750 4204310..4205503 + 1194 WP_008805438.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
EW050_RS20755 4205526..4208672 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit -
EW050_RS20765 4209155..4209529 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
EW050_RS20770 4209556..4209774 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
EW050_RS20775 4209933..4210499 + 567 WP_008805435.1 maltose O-acetyltransferase -
EW050_RS28425 4210471..4210581 - 111 Protein_4000 hypothetical protein -
EW050_RS20780 4210636..4211106 + 471 WP_008805434.1 YlaC family protein -
EW050_RS20785 4211075..4212532 - 1458 WP_012968814.1 PLP-dependent aminotransferase family protein -
EW050_RS20790 4212633..4213331 + 699 WP_012968815.1 GNAT family N-acetyltransferase -
EW050_RS20795 4213328..4213468 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
EW050_RS20800 4213468..4213731 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T286296 WP_002892050.1 NZ_LR130539:4209556-4209774 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT286296 WP_008805436.1 NZ_LR130539:4209155-4209529 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References