Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1792085..1792675 | Replicon | chromosome |
| Accession | NZ_LR130539 | ||
| Organism | Klebsiella variicola strain AJ055 isolate AJ055 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
| Locus tag | EW050_RS08775 | Protein ID | WP_008804165.1 |
| Coordinates | 1792343..1792675 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
| Locus tag | EW050_RS08770 | Protein ID | WP_012541132.1 |
| Coordinates | 1792085..1792342 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW050_RS08745 | 1787692..1788267 | + | 576 | WP_012541129.1 | hypothetical protein | - |
| EW050_RS08750 | 1788446..1789282 | + | 837 | WP_008804155.1 | alpha/beta hydrolase | - |
| EW050_RS08755 | 1789489..1790460 | + | 972 | WP_023340477.1 | sensor domain-containing diguanylate cyclase | - |
| EW050_RS08760 | 1790457..1791557 | - | 1101 | WP_023340476.1 | hypothetical protein | - |
| EW050_RS08770 | 1792085..1792342 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
| EW050_RS08775 | 1792343..1792675 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EW050_RS08785 | 1792998..1794434 | + | 1437 | WP_016161429.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| EW050_RS08795 | 1794807..1796261 | - | 1455 | WP_087498504.1 | AMP nucleosidase | - |
| EW050_RS08800 | 1796392..1796637 | - | 246 | WP_008804171.1 | signal transduction protein PmrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T286289 WP_008804165.1 NZ_LR130539:1792343-1792675 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LYA2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LZQ3 |