Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 739143..739918 | Replicon | chromosome |
Accession | NZ_LR130539 | ||
Organism | Klebsiella variicola strain AJ055 isolate AJ055 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A2N4Z6P0 |
Locus tag | EW050_RS03670 | Protein ID | WP_032740995.1 |
Coordinates | 739433..739918 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | EW050_RS03665 | Protein ID | WP_004150912.1 |
Coordinates | 739143..739436 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW050_RS03645 | 734399..735001 | - | 603 | WP_012540553.1 | short chain dehydrogenase | - |
EW050_RS03650 | 735099..736010 | + | 912 | WP_012540554.1 | LysR family transcriptional regulator | - |
EW050_RS03655 | 736011..737159 | - | 1149 | WP_008806488.1 | PLP-dependent aspartate aminotransferase family protein | - |
EW050_RS03660 | 737171..738547 | - | 1377 | WP_016161835.1 | cystathionine beta-synthase | - |
EW050_RS03665 | 739143..739436 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
EW050_RS03670 | 739433..739918 | + | 486 | WP_032740995.1 | GNAT family N-acetyltransferase | Toxin |
EW050_RS03675 | 740622..741215 | + | 594 | WP_110185300.1 | hypothetical protein | - |
EW050_RS03680 | 741312..741528 | + | 217 | Protein_714 | transposase | - |
EW050_RS03695 | 742051..742764 | - | 714 | WP_008806478.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 741312..741464 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17618.64 Da Isoelectric Point: 8.5178
>T286287 WP_032740995.1 NZ_LR130539:739433-739918 [Klebsiella variicola]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVH
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVH
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N4Z6P0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |