Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 346128..346714 Replicon chromosome
Accession NZ_LR130539
Organism Klebsiella variicola strain AJ055 isolate AJ055

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag EW050_RS01600 Protein ID WP_012967118.1
Coordinates 346346..346714 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag EW050_RS01595 Protein ID WP_004174006.1
Coordinates 346128..346349 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW050_RS01575 342285..343211 + 927 WP_012540389.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
EW050_RS01580 343208..344485 + 1278 WP_008806971.1 branched chain amino acid ABC transporter permease LivM -
EW050_RS01585 344482..345249 + 768 WP_012967117.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
EW050_RS01590 345251..345964 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
EW050_RS01595 346128..346349 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EW050_RS01600 346346..346714 + 369 WP_012967118.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EW050_RS01605 347006..348322 + 1317 WP_008806974.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
EW050_RS01610 348429..349316 + 888 WP_012967120.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
EW050_RS01615 349313..350158 + 846 WP_008806976.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
EW050_RS01620 350160..351230 + 1071 WP_008806977.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 343208..351967 8759


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(26-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13584.98 Da        Isoelectric Point: 8.6410

>T286285 WP_012967118.1 NZ_LR130539:346346-346714 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGMTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT286285 WP_004174006.1 NZ_LR130539:346128-346349 [Klebsiella variicola]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References