Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5367113..5367738 | Replicon | chromosome |
| Accession | NZ_LR130538 | ||
| Organism | Klebsiella variicola strain AJ292 isolate AJ292 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1F2M041 |
| Locus tag | EW044_RS26300 | Protein ID | WP_008807903.1 |
| Coordinates | 5367113..5367496 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | EW044_RS26305 | Protein ID | WP_004150355.1 |
| Coordinates | 5367496..5367738 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW044_RS26285 | 5364479..5365381 | + | 903 | WP_129676323.1 | formate dehydrogenase subunit beta | - |
| EW044_RS26290 | 5365378..5366013 | + | 636 | WP_129676326.1 | formate dehydrogenase cytochrome b556 subunit | - |
| EW044_RS26295 | 5366010..5366939 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| EW044_RS26300 | 5367113..5367496 | - | 384 | WP_008807903.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EW044_RS26305 | 5367496..5367738 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| EW044_RS26310 | 5367943..5368860 | + | 918 | WP_023296845.1 | alpha/beta hydrolase | - |
| EW044_RS26315 | 5368875..5369816 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
| EW044_RS26320 | 5369861..5370298 | - | 438 | WP_023296844.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EW044_RS26325 | 5370295..5371155 | - | 861 | WP_008807907.1 | virulence factor BrkB family protein | - |
| EW044_RS26330 | 5371149..5371748 | - | 600 | WP_129676329.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T286284 WP_008807903.1 NZ_LR130538:c5367496-5367113 [Klebsiella variicola]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2M041 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |