Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 314312..314898 Replicon chromosome
Accession NZ_LR130538
Organism Klebsiella variicola strain AJ292 isolate AJ292

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag EW044_RS01465 Protein ID WP_002920800.1
Coordinates 314530..314898 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag EW044_RS01460 Protein ID WP_023298302.1
Coordinates 314312..314533 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW044_RS01440 310461..311387 + 927 WP_012540389.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
EW044_RS01445 311384..312661 + 1278 WP_008806971.1 branched chain amino acid ABC transporter permease LivM -
EW044_RS01450 312658..313425 + 768 WP_008806972.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
EW044_RS01455 313427..314140 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
EW044_RS01460 314312..314533 + 222 WP_023298302.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EW044_RS01465 314530..314898 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EW044_RS01470 315190..316506 + 1317 WP_022066271.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
EW044_RS01475 316613..317500 + 888 WP_012967120.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
EW044_RS01480 317497..318342 + 846 WP_008806976.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
EW044_RS01485 318344..319414 + 1071 WP_129675197.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 311384..320151 8767


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T286273 WP_002920800.1 NZ_LR130538:314530-314898 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8123.14 Da        Isoelectric Point: 4.7769

>AT286273 WP_023298302.1 NZ_LR130538:314312-314533 [Klebsiella variicola]
MKTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure

References