Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 273740..274371 | Replicon | chromosome |
Accession | NZ_LR130538 | ||
Organism | Klebsiella variicola strain AJ292 isolate AJ292 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7H4S6Z2 |
Locus tag | EW044_RS01250 | Protein ID | WP_008806943.1 |
Coordinates | 273740..274015 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A7H4S6Z1 |
Locus tag | EW044_RS01255 | Protein ID | WP_023298308.1 |
Coordinates | 274012..274371 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW044_RS01230 | 268976..269311 | + | 336 | WP_002921203.1 | universal stress protein UspB | - |
EW044_RS01235 | 269371..270867 | - | 1497 | WP_008806938.1 | inorganic phosphate transporter PitA | - |
EW044_RS01240 | 271097..272290 | + | 1194 | WP_012967106.1 | NAD(P)/FAD-dependent oxidoreductase | - |
EW044_RS01245 | 272330..273343 | - | 1014 | WP_012540371.1 | magnesium transporter | - |
EW044_RS01250 | 273740..274015 | + | 276 | WP_008806943.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
EW044_RS01255 | 274012..274371 | + | 360 | WP_023298308.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
EW044_RS01260 | 274399..274800 | - | 402 | WP_023298307.1 | nickel-responsive transcriptional regulator NikR | - |
EW044_RS01265 | 274788..275579 | - | 792 | WP_012540373.1 | nickel import ATP-binding protein NikE | - |
EW044_RS01270 | 275576..276340 | - | 765 | WP_008806946.1 | nickel import ATP-binding protein NikD | - |
EW044_RS01275 | 276340..277173 | - | 834 | WP_012967107.1 | nickel ABC transporter permease subunit NikC | - |
EW044_RS01280 | 277170..278114 | - | 945 | WP_016161924.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10295.87 Da Isoelectric Point: 10.3900
>T286272 WP_008806943.1 NZ_LR130538:273740-274015 [Klebsiella variicola]
MEQQVLSLRNKQRHTLEQLFKTPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVRP
MEQQVLSLRNKQRHTLEQLFKTPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVRP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13341.08 Da Isoelectric Point: 4.4605
>AT286272 WP_023298308.1 NZ_LR130538:274012-274371 [Klebsiella variicola]
MIKPKTPNSMEIAGQPAVINYVPELNVFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKMKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
MIKPKTPNSMEIAGQPAVINYVPELNVFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKMKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H4S6Z2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H4S6Z1 |