Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 4722854..4723547 | Replicon | chromosome |
| Accession | NZ_LR130534 | ||
| Organism | Pseudomonas aeruginosa isolate paerg005 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | N2IHR9 |
| Locus tag | EJN62_RS22600 | Protein ID | WP_003151133.1 |
| Coordinates | 4722854..4723231 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | N2IIN5 |
| Locus tag | EJN62_RS22605 | Protein ID | WP_001172026.1 |
| Coordinates | 4723212..4723547 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJN62_RS22585 | 4717965..4718810 | - | 846 | WP_003464995.1 | AraC family transcriptional regulator | - |
| EJN62_RS22590 | 4719047..4722076 | - | 3030 | WP_032432545.1 | Tn3 family transposase | - |
| EJN62_RS22595 | 4722060..4722662 | - | 603 | WP_010465829.1 | recombinase family protein | - |
| EJN62_RS22600 | 4722854..4723231 | + | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EJN62_RS22605 | 4723212..4723547 | + | 336 | WP_001172026.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EJN62_RS22610 | 4723562..4723896 | + | 335 | Protein_4349 | transposase | - |
| EJN62_RS22615 | 4723920..4724246 | + | 327 | WP_000091614.1 | hypothetical protein | - |
| EJN62_RS22620 | 4724243..4724623 | + | 381 | WP_001054412.1 | hypothetical protein | - |
| EJN62_RS22625 | 4724741..4725079 | + | 339 | WP_125080705.1 | DUF3391 domain-containing protein | - |
| EJN62_RS22630 | 4725126..4726040 | + | 915 | WP_001736514.1 | HD domain-containing protein | - |
| EJN62_RS22635 | 4726450..4726689 | + | 240 | WP_034011918.1 | ribbon-helix-helix domain-containing protein | - |
| EJN62_RS22640 | 4726689..4727099 | + | 411 | WP_034011919.1 | putative toxin-antitoxin system toxin component, PIN family | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4705205..4732631 | 27426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T286254 WP_003151133.1 NZ_LR130534:4722854-4723231 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024ELN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024EKI7 |