Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2485579..2486618 | Replicon | chromosome |
Accession | NZ_LR130534 | ||
Organism | Pseudomonas aeruginosa isolate paerg005 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | EJN62_RS11950 | Protein ID | WP_100773622.1 |
Coordinates | 2486043..2486618 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A7L5F0B4 |
Locus tag | EJN62_RS11945 | Protein ID | WP_043156233.1 |
Coordinates | 2485579..2486046 (+) | Length | 156 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN62_RS11910 | 2480958..2482388 | - | 1431 | WP_009516218.1 | TIGR03752 family integrating conjugative element protein | - |
EJN62_RS11915 | 2482378..2483286 | - | 909 | WP_125075551.1 | TIGR03749 family integrating conjugative element protein | - |
EJN62_RS11920 | 2483283..2483972 | - | 690 | WP_100773626.1 | TIGR03746 family integrating conjugative element protein | - |
EJN62_RS11925 | 2483969..2484367 | - | 399 | WP_100773625.1 | TIGR03750 family conjugal transfer protein | - |
EJN62_RS11930 | 2484379..2484738 | - | 360 | WP_100773624.1 | TIGR03745 family integrating conjugative element membrane protein | - |
EJN62_RS11935 | 2484755..2484988 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
EJN62_RS11940 | 2484985..2485365 | - | 381 | WP_100773623.1 | RAQPRD family integrative conjugative element protein | - |
EJN62_RS11945 | 2485579..2486046 | + | 468 | WP_043156233.1 | helix-turn-helix domain-containing protein | Antitoxin |
EJN62_RS11950 | 2486043..2486618 | + | 576 | WP_100773622.1 | PIN domain-containing protein | Toxin |
EJN62_RS11955 | 2486636..2487550 | + | 915 | WP_100773621.1 | AAA family ATPase | - |
EJN62_RS11960 | 2487547..2488017 | + | 471 | WP_100773620.1 | hypothetical protein | - |
EJN62_RS11965 | 2488014..2488514 | + | 501 | WP_100773619.1 | HORMA domain containing protein | - |
EJN62_RS11970 | 2488514..2489416 | + | 903 | WP_100773618.1 | nucleotidyltransferase domain-containing protein | - |
EJN62_RS11975 | 2489453..2490178 | + | 726 | WP_100773617.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2442353..2528671 | 86318 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21570.58 Da Isoelectric Point: 5.6513
>T286252 WP_100773622.1 NZ_LR130534:2486043-2486618 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQTIHEEWKRNLLINRPDLTRAQVDRTSDLMDRAIPDGLVEGY
ESLAAGLTLPDPDDRHVLAAAIRCGASVIVTFNQRDFPNELLAPYGVESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLRN
PTIDVDRYLDILLRQGLVQTTKVLAGYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQTIHEEWKRNLLINRPDLTRAQVDRTSDLMDRAIPDGLVEGY
ESLAAGLTLPDPDDRHVLAAAIRCGASVIVTFNQRDFPNELLAPYGVESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLRN
PTIDVDRYLDILLRQGLVQTTKVLAGYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 156 a.a. Molecular weight: 17251.62 Da Isoelectric Point: 5.9214
>AT286252 WP_043156233.1 NZ_LR130534:2485579-2486046 [Pseudomonas aeruginosa]
MTVTAQSKMTLPAEGEVKAAVQGQRALAAYLATQFETQHIQIFDDQKQAHQVELPTSALRLLVDILAELADGNAVKVVPV
HAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELTQQSQELGMGYE
MTVTAQSKMTLPAEGEVKAAVQGQRALAAYLATQFETQHIQIFDDQKQAHQVELPTSALRLLVDILAELADGNAVKVVPV
HAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELTQQSQELGMGYE
Download Length: 468 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|