Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 143401..143906 | Replicon | chromosome |
Accession | NZ_LR130534 | ||
Organism | Pseudomonas aeruginosa isolate paerg005 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | EJN62_RS00670 | Protein ID | WP_003083773.1 |
Coordinates | 143401..143682 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | EJN62_RS00675 | Protein ID | WP_003083775.1 |
Coordinates | 143679..143906 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN62_RS00645 | 138652..140001 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
EJN62_RS00650 | 140050..140736 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
EJN62_RS00655 | 140837..141571 | + | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
EJN62_RS00660 | 141775..142161 | + | 387 | WP_003083767.1 | aegerolysin family protein | - |
EJN62_RS00665 | 142193..143101 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
EJN62_RS00670 | 143401..143682 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
EJN62_RS00675 | 143679..143906 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
EJN62_RS00680 | 144082..144702 | - | 621 | WP_003101226.1 | hypothetical protein | - |
EJN62_RS00685 | 144803..145303 | + | 501 | WP_003083778.1 | LEA type 2 family protein | - |
EJN62_RS00690 | 145376..145717 | + | 342 | WP_014603467.1 | alkylphosphonate utilization protein | - |
EJN62_RS00695 | 145801..147228 | - | 1428 | WP_003083784.1 | GABA permease | - |
EJN62_RS00700 | 147397..148890 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T286248 WP_003083773.1 NZ_LR130534:c143682-143401 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|