Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 5801490..5802529 | Replicon | chromosome |
Accession | NZ_LR130533 | ||
Organism | Pseudomonas aeruginosa isolate paerg009 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | EJN60_RS27950 | Protein ID | WP_100773622.1 |
Coordinates | 5801954..5802529 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A7L5F0B4 |
Locus tag | EJN60_RS27945 | Protein ID | WP_043156233.1 |
Coordinates | 5801490..5801957 (+) | Length | 156 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN60_RS27910 | 5796869..5798299 | - | 1431 | WP_009516218.1 | TIGR03752 family integrating conjugative element protein | - |
EJN60_RS27915 | 5798289..5799197 | - | 909 | WP_125075551.1 | TIGR03749 family integrating conjugative element protein | - |
EJN60_RS27920 | 5799194..5799883 | - | 690 | WP_100773626.1 | TIGR03746 family integrating conjugative element protein | - |
EJN60_RS27925 | 5799880..5800278 | - | 399 | WP_100773625.1 | TIGR03750 family conjugal transfer protein | - |
EJN60_RS27930 | 5800290..5800649 | - | 360 | WP_100773624.1 | TIGR03745 family integrating conjugative element membrane protein | - |
EJN60_RS27935 | 5800666..5800899 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
EJN60_RS27940 | 5800896..5801276 | - | 381 | WP_100773623.1 | RAQPRD family integrative conjugative element protein | - |
EJN60_RS27945 | 5801490..5801957 | + | 468 | WP_043156233.1 | helix-turn-helix domain-containing protein | Antitoxin |
EJN60_RS27950 | 5801954..5802529 | + | 576 | WP_100773622.1 | PIN domain-containing protein | Toxin |
EJN60_RS27955 | 5802547..5803461 | + | 915 | WP_100773621.1 | AAA family ATPase | - |
EJN60_RS27960 | 5803458..5803928 | + | 471 | WP_100773620.1 | hypothetical protein | - |
EJN60_RS27965 | 5803925..5804425 | + | 501 | WP_100773619.1 | HORMA domain containing protein | - |
EJN60_RS27970 | 5804425..5805327 | + | 903 | WP_100773618.1 | nucleotidyltransferase domain-containing protein | - |
EJN60_RS27975 | 5805364..5806089 | + | 726 | WP_100773617.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5758264..5844582 | 86318 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21570.58 Da Isoelectric Point: 5.6513
>T286247 WP_100773622.1 NZ_LR130533:5801954-5802529 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQTIHEEWKRNLLINRPDLTRAQVDRTSDLMDRAIPDGLVEGY
ESLAAGLTLPDPDDRHVLAAAIRCGASVIVTFNQRDFPNELLAPYGVESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLRN
PTIDVDRYLDILLRQGLVQTTKVLAGYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQTIHEEWKRNLLINRPDLTRAQVDRTSDLMDRAIPDGLVEGY
ESLAAGLTLPDPDDRHVLAAAIRCGASVIVTFNQRDFPNELLAPYGVESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLRN
PTIDVDRYLDILLRQGLVQTTKVLAGYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 156 a.a. Molecular weight: 17251.62 Da Isoelectric Point: 5.9214
>AT286247 WP_043156233.1 NZ_LR130533:5801490-5801957 [Pseudomonas aeruginosa]
MTVTAQSKMTLPAEGEVKAAVQGQRALAAYLATQFETQHIQIFDDQKQAHQVELPTSALRLLVDILAELADGNAVKVVPV
HAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELTQQSQELGMGYE
MTVTAQSKMTLPAEGEVKAAVQGQRALAAYLATQFETQHIQIFDDQKQAHQVELPTSALRLLVDILAELADGNAVKVVPV
HAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELTQQSQELGMGYE
Download Length: 468 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|