Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 3462957..3463462 | Replicon | chromosome |
Accession | NZ_LR130533 | ||
Organism | Pseudomonas aeruginosa isolate paerg009 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | EJN60_RS16680 | Protein ID | WP_003083773.1 |
Coordinates | 3462957..3463238 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | EJN60_RS16685 | Protein ID | WP_003083775.1 |
Coordinates | 3463235..3463462 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN60_RS16655 | 3458208..3459557 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
EJN60_RS16660 | 3459606..3460292 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
EJN60_RS16665 | 3460393..3461127 | + | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
EJN60_RS16670 | 3461331..3461717 | + | 387 | WP_003083767.1 | aegerolysin family protein | - |
EJN60_RS16675 | 3461749..3462657 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
EJN60_RS16680 | 3462957..3463238 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
EJN60_RS16685 | 3463235..3463462 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
EJN60_RS16690 | 3463638..3464258 | - | 621 | WP_003101226.1 | hypothetical protein | - |
EJN60_RS16695 | 3464359..3464859 | + | 501 | WP_003083778.1 | LEA type 2 family protein | - |
EJN60_RS16700 | 3464932..3465273 | + | 342 | WP_014603467.1 | alkylphosphonate utilization protein | - |
EJN60_RS16705 | 3465357..3466784 | - | 1428 | WP_003083784.1 | GABA permease | - |
EJN60_RS16710 | 3466953..3468446 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T286243 WP_003083773.1 NZ_LR130533:c3463238-3462957 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|