Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 36737..37430 | Replicon | chromosome |
Accession | NZ_LR130533 | ||
Organism | Pseudomonas aeruginosa isolate paerg009 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | EJN60_RS00235 | Protein ID | WP_003151133.1 |
Coordinates | 37053..37430 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | EJN60_RS00230 | Protein ID | WP_001172026.1 |
Coordinates | 36737..37072 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN60_RS00195 | 33164..33574 | - | 411 | WP_034011919.1 | putative toxin-antitoxin system toxin component, PIN family | - |
EJN60_RS00200 | 33574..33813 | - | 240 | WP_034011918.1 | ribbon-helix-helix domain-containing protein | - |
EJN60_RS00205 | 34223..35137 | - | 915 | WP_001736514.1 | HD domain-containing protein | - |
EJN60_RS00210 | 35184..35543 | - | 360 | WP_125075509.1 | DUF3391 domain-containing protein | - |
EJN60_RS00215 | 35661..36041 | - | 381 | WP_001054412.1 | hypothetical protein | - |
EJN60_RS00220 | 36038..36364 | - | 327 | WP_000091614.1 | hypothetical protein | - |
EJN60_RS00225 | 36388..36722 | - | 335 | Protein_40 | transposase | - |
EJN60_RS00230 | 36737..37072 | - | 336 | WP_001172026.1 | helix-turn-helix domain-containing protein | Antitoxin |
EJN60_RS00235 | 37053..37430 | - | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EJN60_RS00240 | 37622..38224 | + | 603 | WP_010465829.1 | recombinase family protein | - |
EJN60_RS00245 | 38208..41237 | + | 3030 | WP_032432545.1 | Tn3 family transposase | - |
EJN60_RS00250 | 41474..42319 | + | 846 | WP_003464995.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 27990..55447 | 27457 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T286239 WP_003151133.1 NZ_LR130533:c37430-37053 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |