Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3986938..3987592 | Replicon | chromosome |
Accession | NZ_LR130532 | ||
Organism | Escherichia coli isolate ecoli019 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | EJK95_RS19460 | Protein ID | WP_000244781.1 |
Coordinates | 3986938..3987345 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | EJK95_RS19465 | Protein ID | WP_000354046.1 |
Coordinates | 3987326..3987592 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJK95_RS19440 | 3982895..3984628 | - | 1734 | WP_000813218.1 | single-stranded-DNA-specific exonuclease RecJ | - |
EJK95_RS19445 | 3984634..3985344 | - | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EJK95_RS19450 | 3985369..3986265 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
EJK95_RS19455 | 3986377..3986898 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
EJK95_RS19460 | 3986938..3987345 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
EJK95_RS19465 | 3987326..3987592 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
EJK95_RS19470 | 3987835..3988815 | + | 981 | WP_000886095.1 | tRNA-modifying protein YgfZ | - |
EJK95_RS19475 | 3989011..3989670 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
EJK95_RS19480 | 3989834..3990145 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
EJK95_RS19485 | 3990190..3991623 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
EJK95_RS19490 | 3991680..3992423 | - | 744 | WP_000951951.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T286234 WP_000244781.1 NZ_LR130532:c3987345-3986938 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PAM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |