Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 3845490..3846073 | Replicon | chromosome |
| Accession | NZ_LR130532 | ||
| Organism | Escherichia coli isolate ecoli019 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | U9XFN8 |
| Locus tag | EJK95_RS18785 | Protein ID | WP_000254745.1 |
| Coordinates | 3845490..3845825 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | EJK95_RS18790 | Protein ID | WP_000581937.1 |
| Coordinates | 3845825..3846073 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJK95_RS18770 | 3841377..3842675 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| EJK95_RS18775 | 3842763..3844400 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| EJK95_RS18780 | 3844628..3845419 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| EJK95_RS18785 | 3845490..3845825 | - | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
| EJK95_RS18790 | 3845825..3846073 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| EJK95_RS18795 | 3846151..3848385 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| EJK95_RS18800 | 3848433..3849734 | - | 1302 | WP_000046785.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T286233 WP_000254745.1 NZ_LR130532:c3845825-3845490 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYM3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 1UB4 | |
| PDB | 5CQX | |
| PDB | 5CQY | |
| PDB | 1MVF | |
| PDB | 2MRN | |
| PDB | 2MRU | |
| AlphaFold DB | A0A7U9LMB4 |