Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3549671..3550296 | Replicon | chromosome |
Accession | NZ_LR130532 | ||
Organism | Escherichia coli isolate ecoli019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EJK95_RS17330 | Protein ID | WP_000911330.1 |
Coordinates | 3549671..3550069 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | EJK95_RS17335 | Protein ID | WP_000450524.1 |
Coordinates | 3550069..3550296 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJK95_RS17310 | 3545578..3545778 | + | 201 | WP_000383836.1 | YpfN family protein | - |
EJK95_RS17315 | 3545859..3546557 | - | 699 | WP_000679812.1 | esterase | - |
EJK95_RS17320 | 3546631..3548646 | - | 2016 | WP_000829354.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
EJK95_RS17325 | 3548661..3549524 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
EJK95_RS17330 | 3549671..3550069 | - | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
EJK95_RS17335 | 3550069..3550296 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
EJK95_RS17340 | 3550450..3551163 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
EJK95_RS17345 | 3551376..3552410 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
EJK95_RS17350 | 3552427..3553305 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
EJK95_RS17355 | 3553451..3554023 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
EJK95_RS17360 | 3554023..3554493 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T286232 WP_000911330.1 NZ_LR130532:c3550069-3549671 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|