Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1182704..1183541 | Replicon | chromosome |
Accession | NZ_LR130532 | ||
Organism | Escherichia coli isolate ecoli019 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | EJK95_RS05600 | Protein ID | WP_000227784.1 |
Coordinates | 1182704..1183246 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | EJK95_RS05605 | Protein ID | WP_001297137.1 |
Coordinates | 1183230..1183541 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJK95_RS05580 | 1178248..1179159 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
EJK95_RS05585 | 1179327..1179818 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
EJK95_RS05590 | 1179946..1181310 | - | 1365 | WP_001000978.1 | MFS transporter | - |
EJK95_RS05595 | 1181713..1182648 | + | 936 | WP_001297127.1 | sel1 repeat family protein | - |
EJK95_RS05600 | 1182704..1183246 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
EJK95_RS05605 | 1183230..1183541 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
EJK95_RS05610 | 1183726..1184616 | - | 891 | WP_000971336.1 | heme o synthase | - |
EJK95_RS05615 | 1184628..1184957 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
EJK95_RS05620 | 1184957..1185571 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
EJK95_RS05625 | 1185561..1187552 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
EJK95_RS05630 | 1187574..1188521 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T286218 WP_000227784.1 NZ_LR130532:c1183246-1182704 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|